PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g080460.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 375aa    MW: 42389.5 Da    PI: 6.236
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g080460.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.2e-30218272155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rW+++LH+rF+e+v++LGG++kAtPk+il+lm+ ++Ltl+hvkSHLQkYR 
  Sopim10g080460.0.1 218 KTRIRWNEDLHDRFLECVNRLGGADKATPKQILNLMDSDCLTLDHVKSHLQKYRN 272
                         68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.561215275IPR017930Myb domain
SuperFamilySSF466891.97E-15216272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-26216273IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25218273IPR006447Myb domain, plants
PfamPF143791.0E-19301347IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MSIQRFIITQ GNEYFSSDYS IEVSKNSAQN LVDQEIQYPS YMGTCLPIAS SSSSSIINCI  60
GSPSSAFFAT ERCLGLTQYD NQYDTSELIK NCDVQMSSFD PQQCKNGILK DPLVQAEPDF  120
RHEISMPSFI RTEFSTSPFS DVSEAEKESL LHLKNELLGE FDTSYRRHPS LPFHGNQDYC  180
LSHDLCCSQL ANTRQQPASP SLTFHNSASS GVFHKPSKTR IRWNEDLHDR FLECVNRLGG  240
ADKATPKQIL NLMDSDCLTL DHVKSHLQKY RNAKHPESVG KSEKRNSSDA MTDIESKTGR  300
EIKEALKMQL EVQRCLHEQL ETQRTLQMRI EEQAKKLKMI LDQQRKTNMT LLGTRNSNIS  360
SPGVEILVVQ DSDN*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2442860.0AC244286.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-20a14 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249281.10.0PREDICTED: uncharacterized protein LOC101261766
TrEMBLK4D2T60.0K4D2T6_SOLLC; Uncharacterized protein
STRINGSolyc10g080460.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-54G2-like family protein